PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G007600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARF
Protein Properties Length: 698aa    MW: 77886.9 Da    PI: 7.0404
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G007600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.62.7e-24130230198
                          EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                          f+kvlt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   
  Manes.02G007600.1.p 130 FCKVLTASDTSTHGGFSVLRKHATEClpqldMAQPTPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL-- 217
                          99****************************9666777789************************************************.. PP

                          SSSEE..EEEEE- CS
                   B3  86 grsefelvvkvfr 98 
                          + +++el+v+v+r
  Manes.02G007600.1.p 218 RGKNGELRVGVRR 230
                          4499999****98 PP

2Auxin_resp1058.9e-35256335183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha++t++ F v+Y+Pr+  s+F+++++k+++a+++k++vGmRfkm+fe+eds+ rr+sGt+vgv+d++p +W +SkWr+Lk
  Manes.02G007600.1.p 256 ASHAVATQTLFVVYYKPRT--SQFIISLNKYLEAINNKFAVGMRFKMRFEGEDSPDRRFSGTIVGVEDFSP-HWADSKWRQLK 335
                          789***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.09E-39124259IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.4E-40126245IPR015300DNA-binding pseudobarrel domain
CDDcd100175.44E-21128230No hitNo description
PROSITE profilePS5086312.153130232IPR003340B3 DNA binding domain
PfamPF023622.4E-22130230IPR003340B3 DNA binding domain
SMARTSM010191.9E-22130232IPR003340B3 DNA binding domain
PfamPF065075.2E-32256335IPR010525Auxin response factor
PfamPF023091.3E-12573668IPR033389AUX/IAA domain
SuperFamilySSF542775.4E-14580661No hitNo description
PROSITE profilePS5174528.075585666IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MMAANQSGSF SQANNEGCAG GDDMYTELWK ACAGPLVDVP RNGERVYYFP QGHMEQLEAS  60
TNQELNQRVP LFNLPSKILC RVIHIQLLAE QETDEVYAQI TLLPEPDQAE LTCPDPLPSE  120
PSRCPTVHSF CKVLTASDTS THGGFSVLRK HATECLPQLD MAQPTPTQEL VAKDLHGYEW  180
RFKHIFRGQP RRHLLTTGWS TFVTSKRLVA GDSFVFLRGK NGELRVGVRR LARQQSNMPS  240
SVISSQSMHL GVLATASHAV ATQTLFVVYY KPRTSQFIIS LNKYLEAINN KFAVGMRFKM  300
RFEGEDSPDR RFSGTIVGVE DFSPHWADSK WRQLKVQWDE SASIPRPDKV SPWEIEPFSS  360
SVPMNIAQPV AVKNKRPRPP VEIPTLDLSS TAAPPWDSRL TQSHDLTQMS GTAEGKRKEN  420
HFIWHHKQTG INSHSNSISR SPTEGGWLSS PHVNVSRHLF QEATEDSKSV SNWPVISCYS  480
TPQSAKLKND TILDPVEKGR KTEAASSYRL FGIELINHST SSPVEKAPAQ PVSVSSGTTE  540
GHVLSTLSAT DSDKKSDISK EKKPEHLHVP PKDVQSRQSC SSSTRSCTKV HMQGVAVGRA  600
IDLTVMKGYD QLLDELEEMF DIRGQLHRRE KWEIVYTDDE GDMMLVGDDP WPEFCNMVRR  660
IFICLSQDVK KTTPGSKLPM FSIEGEGTIV SSNLTDN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-17613601357Auxin response factor 1
4ldw_A1e-17613601357Auxin response factor 1
4ldv_A1e-17613601357Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1374378KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086686.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A067K0G30.0A0A067K0G3_JATCU; Auxin response factor
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15113396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9